Loading...
Statistics
Advertisement

Survey Guide
www.afrocan.se/
Survey Guide

Afrocan.se

Advertisement
Conversion Technology Metas Server
Afrocan.se is hosted in Sweden / Karlstad . Afrocan.se uses HTTPS protocol. Number of used technologies: 8. First technologies: AJAX Libraries API, CSS, Font Awesome, Number of used javascripts: 13. First javascripts: Jquery.min.js, Bootstrap.min.js, Angular.min.js, Number of used analytics tools: 0. Its server type is: Apache/2.2.14 (Ubuntu).

Technologies in use by Afrocan.se

Technology

Number of occurences: 8
  • AJAX Libraries API
  • CSS
  • Font Awesome
  • Google Font API
  • Html
  • Html5
  • Iframe
  • Javascript

Advertisement

Javascripts

Number of occurences: 13
  • jquery.min.js
  • bootstrap.min.js
  • angular.min.js
  • angular-route.min.js
  • ui-bootstrap-tpls-0.12.0.js
  • promise-tracker.js
  • angular-file-upload.js
  • angular-webstorage.js
  • app.js
  • script.js
  • service.js
  • Category.js
  • Home.js

Server Type

  • Apache/2.2.14 (Ubuntu)

Powered by

  • PHP/5.3.2-1ubuntu4.14

CDN

Number of occurences: 2
  • BootstrapCDN
  • Maxcdn

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Afrocan.se

SSL certificate

    • name: /OU=Domain Control Validated/CN=tracking.webconvertmedia.com
    • subject:
      • OU: Domain Control Validated
      • CN: tracking.webconvertmedia.com
    • hash: f94fbe47
    • issuer:
      • C: US
      • ST: Arizona
      • L: Scottsdale
      • O: GoDaddy.com, Inc.
      • OU: http://certs.godaddy.com/repository/
      • CN: Go Daddy Secure Certificate Authority - G2
    • version: 2
    • serialNumber: 7556312084542017529
    • validFrom: 150527085038Z
    • validTo: 160526155443Z
    • validFrom_time_t: 1432716638
    • validTo_time_t: 1464278083
    • extensions:
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • keyUsage: Digital Signature, Key Encipherment
      • crlDistributionPoints: Full Name: URI:http://crl.godaddy.com/gdig2s1-87.crl
      • certificatePolicies: Policy: 2.16.840.1.114413.1.7.23.1 CPS: http://certificates.godaddy.com/repository/
      • authorityInfoAccess: OCSP - URI:http://ocsp.godaddy.com/ CA Issuers - URI:http://certificates.godaddy.com/repository/gdig2.crt
      • authorityKeyIdentifier: keyid:40:C2:BD:27:8E:CC:34:83:30:A2:33:D7:FB:6C:B3:F0:B4:2C:80:CE
      • subjectAltName: DNS:tracking.webconvertmedia.com, DNS:www.tracking.webconvertmedia.com
      • subjectKeyIdentifier: 20:81:54:CB:41:B6:65:B5:88:F1:9C:0E:2A:37:4A:3C:7F:08:E3:17

Meta - Afrocan.se

Number of occurences: 3
  • Name:
    Content: IE=edge, chrome=1
  • Name: viewport
    Content: width=device-width, initial-scale=1.0
  • Name: description
    Content: Survey Guide

Server / Hosting

  • IP: 213.180.93.23
  • Latitude: 59.37
  • Longitude: 13.50
  • Country: Sweden
  • City: Karlstad

Rname

  • ns75.domaincontrol.com
  • ns76.domaincontrol.com
  • smtp.secureserver.net
  • mailstore1.secureserver.net

Target

  • dns.jomax.net

HTTP Header Response

HTTP/1.1 200 OK Date: Wed, 28 Sep 2016 12:34:11 GMT Server: Apache/2.2.14 (Ubuntu) X-Powered-By: PHP/5.3.2-1ubuntu4.14 Set-Cookie: PHPSESSID=47j4mjhh484ljd8shbpue4ph83; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache Vary: Accept-Encoding Content-Type: text/html; charset=UTF-8 X-Cache: MISS from s_hv897 Transfer-Encoding: chunked Via: 1.1 s_hv897 (squid/3.5.20) Connection: keep-alive

DNS

host: afrocan.se
  1. class: IN
  2. ttl: 600
  3. type: A
  4. ip: 213.180.93.23
host: afrocan.se
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns75.domaincontrol.com
host: afrocan.se
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns76.domaincontrol.com
host: afrocan.se
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns75.domaincontrol.com
  5. rname: dns.jomax.net
  6. serial: 2016081700
  7. refresh: 28800
  8. retry: 7200
  9. expire: 604800
  10. minimum-ttl: 600
host: afrocan.se
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 0
  5. target: smtp.secureserver.net
host: afrocan.se
  1. class: IN
  2. ttl: 3600
  3. type: MX
  4. pri: 10
  5. target: mailstore1.secureserver.net

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.frocan.se, www.aofrocan.se, www.ofrocan.se, www.apfrocan.se, www.pfrocan.se, www.a9frocan.se, www.9frocan.se, www.afrocan.se, www.frocan.se, www.aifrocan.se, www.ifrocan.se, www.aufrocan.se, www.ufrocan.se, www.arocan.se, www.afqrocan.se, www.aqrocan.se, www.afrocan.se, www.arocan.se, www.afarocan.se, www.aarocan.se, www.afyrocan.se, www.ayrocan.se, www.aftrocan.se, www.atrocan.se, www.afgrocan.se, www.agrocan.se, www.afbrocan.se, www.abrocan.se, www.afwrocan.se, www.awrocan.se, www.afsrocan.se, www.asrocan.se, www.afdrocan.se, www.adrocan.se, www.afrrocan.se, www.arrocan.se, www.af3rocan.se, www.a3rocan.se, www.af4rocan.se, www.a4rocan.se, www.afocan.se, www.afriocan.se, www.afiocan.se, www.afroocan.se, www.afoocan.se, www.afrlocan.se, www.aflocan.se, www.afrlocan.se, www.aflocan.se, www.afr.ocan.se, www.af.ocan.se, www.afrcan.se, www.afrobcan.se, www.afrbcan.se, www.afrohcan.se, www.afrhcan.se, www.afrogcan.se, www.afrgcan.se, www.afrojcan.se, www.afrjcan.se, www.afromcan.se, www.afrmcan.se, www.afro can.se, www.afr can.se, www.afrovcan.se, www.afrvcan.se, www.afroan.se, www.afrocdan.se, www.afrodan.se, www.afrocran.se, www.afroran.se, www.afroctan.se, www.afrotan.se, www.afrocvan.se, www.afrovan.se, www.afrocfan.se, www.afrofan.se, www.afrocgan.se, www.afrogan.se, www.afrochan.se, www.afrohan.se, www.afrocnan.se, www.afronan.se, www.afrocman.se, www.afroman.se, www.afrocjan.se, www.afrojan.se, www.afrocn.se, www.afrocaon.se, www.afrocon.se, www.afrocapn.se, www.afrocpn.se, www.afroca9n.se, www.afroc9n.se, www.afrocan.se, www.afrocn.se, www.afrocain.se, www.afrocin.se, www.afrocaun.se, www.afrocun.se, www.afroca.se, www.afrocann.se, www.afrocan.se, www.afrocanh.se, www.afrocah.se, www.afrocanj.se, www.afrocaj.se, www.afrocank.se, www.afrocak.se, www.afrocanl.se, www.afrocal.se, www.afrocan .se, www.afroca .se,

Other websites we recently analyzed

  1. 辽化教育基金
    Hangzhou (China) - 121.42.112.1
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 5
    Number of meta tags: 3
  2. 首页-深圳市凯利盈科技有限公司
    首页
    Central District (Hong Kong) - 113.10.244.56
    Server software: Microsoft-IIS/6.0
    Technology: CSS, Html, Javascript, jQuery, Php
    Number of Javascript: 10
    Number of meta tags: 4
  3. supremelogisticsllc.com
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  4. apztec Support
    Ashburn (United States) - 54.88.230.97
    Server software: nginx/1.11.3
    Technology: CSS, Html, Javascript, Php
    Number of Javascript: 3
    Number of meta tags: 1
  5. rosanne.
    San Francisco (United States) - 192.0.78.24
    Server software: nginx
    Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, SVG, comScore, Wordpress
    Number of Javascript: 6
    Number of meta tags: 9
  6. Fotos
    Dallas (United States) - 67.228.150.34
    Server software: Microsoft-IIS/7.5
    Technology: Html
    Number of meta tags: 1
  7. pennsylvaniamalpracticelawyers.info
    Scottsdale (United States) - 50.63.202.62
    Server software:
    Technology: Html, Html5, Iframe
  8. Pet Kraft
    United States - 208.91.199.87
    Server software: Apache Phusion_Passenger/4.0.10 mod_bwlimited/1.4 mod_fcgid/2.3.9
    Technology: CSS, Html, Javascript, jQuery, Php
    Number of Javascript: 8
    Number of meta tags: 1
  9. califoncoffee.com
    Scottsdale (United States) - 184.168.221.61
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe
  10. donateordance.net
    Scottsdale (United States) - 184.168.221.63
    Server software: Microsoft-IIS/7.5
    Technology: Html, Html5, Iframe

Check Other Websites